Cagrilintide 10mg
What is Cagrilintide?
Cagrilintide (research designation AM833) is a synthetic 37-amino-acid long-acting amylin analog characterized by lipid-modified backbone substitutions that extend research stability significantly compared to native amylin. With a molecular weight of approximately 4,213.9 Da, it was first described in published metabolic research literature in 2017 and has been studied alongside GL 1P receptor agonists in research models investigating combined amylin and incretin pathway signaling. Also searched as AM833, long-acting amylin, or cagrilintide 10mg, it is supplied as a lyophilized powder for laboratory reference use. Triumphant Labs Cagrilintide is provided strictly for in vitro research applications and is not approved for human or animal use.
$100.00
Certificate of Analysis (click to view)

Triumphant Labs products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
Research Chemicals ARE NOT DIETARY SUPPLEMENTS OR PRESCRIPTION MEDICATIONS THEY ARE *RESEARCH CHEMICALS.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Please review our Terms & Conditions before making a purchase.
Triumphant Labs products are furnished for laboratory research use only. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law. Research Chemicals are not dietary supplements or prescription medications they are *research chemicals.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Disclaimer: All references to “research subjects” or “test subjects” or and reference to “research” throughout this article refer to research conducted on non human non veterinary research subjects such as rats and mice. If we find that your intent is to use them outside of a legal manner we will no longer sell to you. To purchase Research Subjects visit The Jackson Laboratory.
Cagrilintide Structure

Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula
Molecular Weight
4409.01 g/mol
PubChem SID
171397054
CAS Number
1415456-99-3
Synonyms
AT42613, AM833[1]









